PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00755.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CO-like
Protein Properties Length: 346aa    MW: 37997.5 Da    PI: 6.4994
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00755.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.94.3e-081958340
                 zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg..Htvv 40
                             +r C+ +++  +  fC+ ++ +lC +C   +H++  H++v
  Rsa1.0_00755.1_g00004.1 19 ARSCDACQSVSAAVFCRVDSAFLCITCDARIHSYtrHERV 58
                             578******99*********************87889876 PP

2zf-B_box26.51.3e-0859103442
                 zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                                C+ +e+ ++   C+ +   lC +C + +H+       H++vp+
  Rsa1.0_00755.1_g00004.1  59 FLCEVCEQAPAAVTCKADAAALCVTCDSDIHSAnplasrHERVPV 103
                              68*****************************66999999999986 PP

3CCT705.9e-24278321144
                      CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                              Rea++lRY+eKrk+RkFeK+irY+sRKa+AesRpR+KGrF+k++
  Rsa1.0_00755.1_g00004.1 278 REARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRT 321
                              9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.6E-61760IPR000315B-box-type zinc finger
PROSITE profilePS501199.8971760IPR000315B-box-type zinc finger
PfamPF006432.9E-62058IPR000315B-box-type zinc finger
CDDcd000213.59E-82060No hitNo description
PROSITE profilePS5011910.80856103IPR000315B-box-type zinc finger
PfamPF006431.8E-659103IPR000315B-box-type zinc finger
CDDcd000211.97E-859103No hitNo description
SMARTSM003364.6E-1061103IPR000315B-box-type zinc finger
PfamPF062035.3E-18278320IPR010402CCT domain
PROSITE profilePS5101716.817278320IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGFGLENIKS ISGGWGAAAR SCDACQSVSA AVFCRVDSAF LCITCDARIH SYTRHERVFL  60
CEVCEQAPAA VTCKADAAAL CVTCDSDIHS ANPLASRHER VPVESFFDSA VAKISASTFG  120
IVGDSAAVDL TAVPVMGGSE DLGLCPWLLP NDFNEPAKTE MKPSEFVFSD FDRLIDFEYP  180
NTFNNHHPPQ HNSSGADSLV PVQTKTEPLP LTKNDHCFDI DFCRSKLSAF TYPTQSISHS  240
VSTSSLEYGV VPDGNTSSEI SIPVNRNTTG DQASSMNREA RVLRYREKRK NRKFEKTIRY  300
ASRKAYAESR PRIKGRFAKR TETENDDVFL SHVYASAAQY GVVPTF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894790.0AC189479.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB081M20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009120283.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5
SwissprotQ9FHH80.0COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A0D3EC700.0A0A0D3EC70_BRAOL; Uncharacterized protein
STRINGBra020425.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78992435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.10.0CONSTANS-like 5